Mouse Anti-COPS9 Antibody (MO-AB-10576R)


Cat: MO-AB-10576R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10576R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO10576R 100 µg
MO-AB-24985H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24985C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO10576R
SpecificityThis antibody binds to Cattle COPS9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle COPS9 Antibody is a mouse antibody against COPS9. It can be used for COPS9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyeloma-overexpressed gene 2 protein homolog; MYEOV2
UniProt IDQ32PD7
Protein RefseqThe length of the protein is 57 amino acids long.
The sequence is show below: MKPAVDEMFPEGAGPYVDLDEAGGSTGLLMDLAANEKAVHADFFNDFEDLFDDDDIQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry