Mouse Anti-COQ3 Antibody (CBMOAB-00791CR)
Cat: CBMOAB-00791CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00791CR | Monoclonal | Yeast, A. aegpti (Aedes aegpti), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO00791CR | 100 µg | ||
CBMOAB-26426FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO26426FC | 100 µg | ||
CBMOAB-39734FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39734FYA | 100 µg | ||
CBMOAB-71336FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71336FYA | 100 µg | ||
CBMOAB-00018HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO00018HB | 100 µg | ||
CBMOAB-61835FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO61835FYC | 100 µg | ||
MO-AB-02389W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02389W | 100 µg | ||
MO-AB-03552W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03552W | 100 µg | ||
MO-AB-26620W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26620W | 100 µg | ||
MO-AB-29688W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29688W | 100 µg | ||
MO-AB-43020W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43020W | 100 µg | ||
MO-AB-44133W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44133W | 100 µg | ||
MO-AB-53414W | Monoclonal | Marmoset | WB, ELISA | MO53414W | 100 µg | ||
MO-AB-10583R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10583R | 100 µg | ||
MO-AB-00118H | Monoclonal | Arabidopsis (Arabidopsis lyrata) | WB, ELISA | MO00118C | 100 µg | ||
MO-AB-05174Y | Monoclonal | A. aegpti (Aedes aegpti) | WB, ELISA | MO05174Y | 100 µg | ||
MO-AB-11027Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11027Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, A. aegpti (Aedes aegpti), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Fruit fly (Drosophila melanogaster), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO00791CR |
Specificity | This antibody binds to Yeast COQ3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | O-methyltransferase that catalyzes the 2 O-methylation steps in the ubiquinone biosynthetic pathway. Catalyzes the methylation of 3,4-dihydroxy-5-hexaprenylbenzoate (DHHB) to 3-methoxy-4-hydroxy-5-hexaprenylbenzoate (HMHB) and the methylation of 2-hexaprenyl-3-methyl-5-hydroxy-6-methoxy-1,4-benzoquinol (3-demethylubiquinol-6) to ubiquinol-6. |
Product Overview | Mouse Anti-Yeast COQ3 Antibody is a mouse antibody against COQ3. It can be used for COQ3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial; EC 2.1.1.114; 2-polyprenyl-6-hydroxyphenol methylase; EC 2.1.1.222; 3, 4-dihydroxy-5-hexaprenylbenzoate methyltransferase; DHHB methyltransferase; DHHB-MT; DHHB-MTase; 3-demethylubiquinone-6 3-m; COQ3; YOL096C |
UniProt ID | P27680 |
Protein Refseq | The length of the protein is 312 amino acids long. The sequence is show below: MLLRSRFLKVIHVRKQLSACSRFAIQTQTRCKSTDASEDEVKHFQELAPTWWDTDGSQRILHKMNLTRLDFVQRTVRNQVKIQNPEIFVPGFNYKEFLPEYVCDNIQREMQESIETNLDKRPEVSVLDVGCGGGILSESLARLKWVKNVQGIDLTRDCIMVAKEHAKKDPMLEGKINYECKALEDVTGQFDIITCMEMLEHVDMPSEILRHCWSRLNPEKGILFLSTINRDLISWFTTIFMGENVLKIVPKGTHHLSKYINSKEILAWFNDNYSGQFRLLDLKGTMYLPYQGWVEHDCSDVGNYFMAIQRLN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry