Mouse Anti-COQ6 Antibody (CBMOAB-00794CR)


Cat: CBMOAB-00794CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00794CR Monoclonal Yeast, A. aegpti (Aedes aegpti), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO00794CR 100 µg
CBMOAB-02096HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO02096HB 100 µg
CBMOAB-39739FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO39739FYA 100 µg
CBMOAB-71342FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71342FYA 100 µg
MO-AB-02392W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02392W 100 µg
MO-AB-02577H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02577C 100 µg
MO-AB-03554W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03554W 100 µg
MO-AB-05173Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO05173Y 100 µg
MO-AB-10588R Monoclonal Cattle (Bos taurus) WB, ELISA MO10588R 100 µg
MO-AB-11004W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11004W 100 µg
MO-AB-11030Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11030Y 100 µg
MO-AB-27496W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27496W 100 µg
MO-AB-53416W Monoclonal Marmoset WB, ELISA MO53416W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. aegpti (Aedes aegpti), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO00794CR
SpecificityThis antibody binds to Yeast COQ6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFAD-dependent monooxygenase required for the C5-ring hydroxylation during ubiquinone biosynthesis. Catalyzes the hydroxylation of 3-hexaprenyl-4-hydroxybenzoic acid (HHB) to 3-hexaprenyl-4,5-dihydroxybenzoic acid (DHHB). The electrons required for the hydroxylation reaction may be funneled indirectly from NADPH via ferredoxin (YAH1) and ferredoxin reductase (ARH1) to COQ6 (By similarity) (PubMed:21944752). Can also convert 3-hexaprenyl-4-aminobenzoic acid (HAB), a COQ2-prenylated pABA, to DHHB in a too step process. HAB is first hydroxylated at C5 to yield 3-hexaprenyl-4-amino-5-hydroxybenzoic acid (HHAB) which is further deaminated at C4 by COQ6 to produce DHHB (PubMed:26260787).
Product OverviewMouse Anti-Yeast COQ6 Antibody is a mouse antibody against COQ6. It can be used for COQ6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquinone biosynthesis monooxygenase COQ6; EC 1.14.13; COQ6; YGR255C
UniProt IDP53318
Protein RefseqThe length of the protein is 479 amino acids long. The sequence is show below: MFFSKVMLTRRILVRGLATAKSSAPKLTDVLIVGGGPAGLTLAASIKNSPQLKDLKTTLVDMVDLKDKLSDFYNSPPDYFTNRIVSVTPRSIHFLENNAGATLMHDRIQSYDGLYVTDGCSKATLDLARDSMLCMIEIINIQASLYNRISQYDSKKDSIDIIDNTKVVNIKHSDPNDPLSWPLVTLSNGEVYKTRLLVGADGFNSPTRRFSQIPSRGWMYNAYGVVASMKLEYPPFKLRGWQRFLPTGPIAHLPMPENNATLVWSSSERLSRLLLSLPPESFTALINAAFVLEDADMNYYYRTLEDGSMDTDKLIEDIKFRTEEIYATLKDESDIDEIYPPRVVSIIDKTRARFPLKLTHADRYCTDRVALVGDAAHTTHPLAGQGLNMGQTDVHGLVYALEKAMERGLDIGSSLSLEPFWAERYPSNNVLLGMADKLFKLYHTNFPPVVALRTFGLNLTNKIGPVKNMIIDTLGGNEK.
For Research Use Only | Not For Clinical Use.
Online Inquiry