Mouse Anti-COQ6 Antibody (CBMOAB-00794CR)
Cat: CBMOAB-00794CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-00794CR | Monoclonal | Yeast, A. aegpti (Aedes aegpti), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO00794CR | 100 µg | ||
CBMOAB-02096HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO02096HB | 100 µg | ||
CBMOAB-39739FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO39739FYA | 100 µg | ||
CBMOAB-71342FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71342FYA | 100 µg | ||
MO-AB-02392W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO02392W | 100 µg | ||
MO-AB-02577H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02577C | 100 µg | ||
MO-AB-03554W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO03554W | 100 µg | ||
MO-AB-05173Y | Monoclonal | A. aegpti (Aedes aegpti) | WB, ELISA | MO05173Y | 100 µg | ||
MO-AB-10588R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10588R | 100 µg | ||
MO-AB-11004W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11004W | 100 µg | ||
MO-AB-11030Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11030Y | 100 µg | ||
MO-AB-27496W | Monoclonal | Cottonwood (Populus deltoids) | WB, ELISA | MO27496W | 100 µg | ||
MO-AB-53416W | Monoclonal | Marmoset | WB, ELISA | MO53416W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Yeast, A. aegpti (Aedes aegpti), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Cottonwood (Populus deltoids), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
Clone | MO00794CR |
Specificity | This antibody binds to Yeast COQ6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | FAD-dependent monooxygenase required for the C5-ring hydroxylation during ubiquinone biosynthesis. Catalyzes the hydroxylation of 3-hexaprenyl-4-hydroxybenzoic acid (HHB) to 3-hexaprenyl-4,5-dihydroxybenzoic acid (DHHB). The electrons required for the hydroxylation reaction may be funneled indirectly from NADPH via ferredoxin (YAH1) and ferredoxin reductase (ARH1) to COQ6 (By similarity) (PubMed:21944752). Can also convert 3-hexaprenyl-4-aminobenzoic acid (HAB), a COQ2-prenylated pABA, to DHHB in a too step process. HAB is first hydroxylated at C5 to yield 3-hexaprenyl-4-amino-5-hydroxybenzoic acid (HHAB) which is further deaminated at C4 by COQ6 to produce DHHB (PubMed:26260787). |
Product Overview | Mouse Anti-Yeast COQ6 Antibody is a mouse antibody against COQ6. It can be used for COQ6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ubiquinone biosynthesis monooxygenase COQ6; EC 1.14.13; COQ6; YGR255C |
UniProt ID | P53318 |
Protein Refseq | The length of the protein is 479 amino acids long. The sequence is show below: MFFSKVMLTRRILVRGLATAKSSAPKLTDVLIVGGGPAGLTLAASIKNSPQLKDLKTTLVDMVDLKDKLSDFYNSPPDYFTNRIVSVTPRSIHFLENNAGATLMHDRIQSYDGLYVTDGCSKATLDLARDSMLCMIEIINIQASLYNRISQYDSKKDSIDIIDNTKVVNIKHSDPNDPLSWPLVTLSNGEVYKTRLLVGADGFNSPTRRFSQIPSRGWMYNAYGVVASMKLEYPPFKLRGWQRFLPTGPIAHLPMPENNATLVWSSSERLSRLLLSLPPESFTALINAAFVLEDADMNYYYRTLEDGSMDTDKLIEDIKFRTEEIYATLKDESDIDEIYPPRVVSIIDKTRARFPLKLTHADRYCTDRVALVGDAAHTTHPLAGQGLNMGQTDVHGLVYALEKAMERGLDIGSSLSLEPFWAERYPSNNVLLGMADKLFKLYHTNFPPVVALRTFGLNLTNKIGPVKNMIIDTLGGNEK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry