Mouse Anti-COX14 Antibody (CBMOAB-00816CR)
Cat: CBMOAB-00816CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00816CR | Monoclonal | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO00816CR | 100 µg | ||
| CBMOAB-71381FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71381FYA | 100 µg | ||
| MO-AB-10613R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10613R | 100 µg | ||
| MO-AB-17742W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17742W | 100 µg | ||
| MO-AB-24998H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24998C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO00816CR |
| Specificity | This antibody binds to Yeast COX14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Yeast COX14 Antibody is a mouse antibody against COX14. It can be used for COX14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome c oxidase assembly protein COX14; COX14; YML129C |
| UniProt ID | P39103 |
| Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: MSKYAWYTRVTDTLHRLTVLTLVGGTLYMSGGLAYTLYMNGKKYEQQVTQQKALEEDNQQLQSPTAPPTE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry