Mouse Anti-COX14 Antibody (CBMOAB-00816CR)


Cat: CBMOAB-00816CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-00816CR Monoclonal Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO00816CR 100 µg
CBMOAB-71381FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71381FYA 100 µg
MO-AB-10613R Monoclonal Cattle (Bos taurus) WB, ELISA MO10613R 100 µg
MO-AB-17742W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17742W 100 µg
MO-AB-24998H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24998C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO00816CR
SpecificityThis antibody binds to Yeast COX14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Yeast COX14 Antibody is a mouse antibody against COX14. It can be used for COX14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase assembly protein COX14; COX14; YML129C
UniProt IDP39103
Protein RefseqThe length of the protein is 70 amino acids long. The sequence is show below: MSKYAWYTRVTDTLHRLTVLTLVGGTLYMSGGLAYTLYMNGKKYEQQVTQQKALEEDNQQLQSPTAPPTE.
For Research Use Only | Not For Clinical Use.
Online Inquiry