Mouse Anti-COX14 Antibody (CBMOAB-00816CR)
Cat: CBMOAB-00816CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00816CR | Monoclonal | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO00816CR | 100 µg | ||
| CBMOAB-71381FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71381FYA | 100 µg | ||
| MO-AB-10613R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10613R | 100 µg | ||
| MO-AB-17742W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17742W | 100 µg | ||
| MO-AB-24998H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24998C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO00816CR |
| Specificity | This antibody binds to Yeast COX14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | COX14 (COX14, Cytochrome C Oxidase Assembly Factor) is a Protein Coding gene. Diseases associated with COX14 include Mitochondrial Complex Iv Deficiency and Muscular Dystrophy, Congenital, Megaconial Type. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. |
| Product Overview | Mouse Anti-Yeast COX14 Antibody is a mouse antibody against COX14. It can be used for COX14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome c oxidase assembly protein COX14; COX14; YML129C |
| UniProt ID | P39103 |
| Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: MSKYAWYTRVTDTLHRLTVLTLVGGTLYMSGGLAYTLYMNGKKYEQQVTQQKALEEDNQQLQSPTAPPTE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry