Mouse Anti-COX17 Antibody (CBMOAB-00819CR)
Cat: CBMOAB-00819CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00819CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO00819CR | 100 µg | ||
| CBMOAB-02107HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO02107HB | 100 µg | ||
| CBMOAB-71387FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71387FYA | 100 µg | ||
| MO-AB-02589H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02589C | 100 µg | ||
| MO-AB-11040Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11040Y | 100 µg | ||
| MO-AB-21469W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21469W | 100 µg | ||
| MO-AB-24799R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24799R | 100 µg | ||
| MO-AB-25000H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25000C | 100 µg | ||
| MO-AB-29776W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29776W | 100 µg | ||
| MO-AB-53450W | Monoclonal | Marmoset | WB, ELISA | MO53450W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO00819CR |
| Specificity | This antibody binds to Yeast COX17. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Yeast COX17 Antibody is a mouse antibody against COX17. It can be used for COX17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome c oxidase copper chaperone; COX17; YLL009C |
| UniProt ID | Q12287 |
| Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry