Mouse Anti-COX17 Antibody (CBMOAB-00819CR)
Cat: CBMOAB-00819CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-00819CR | Monoclonal | Yeast, C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO00819CR | 100 µg | ||
| CBMOAB-02107HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO02107HB | 100 µg | ||
| CBMOAB-71387FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71387FYA | 100 µg | ||
| MO-AB-02589H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02589C | 100 µg | ||
| MO-AB-11040Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11040Y | 100 µg | ||
| MO-AB-21469W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21469W | 100 µg | ||
| MO-AB-24799R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24799R | 100 µg | ||
| MO-AB-25000H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25000C | 100 µg | ||
| MO-AB-29776W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29776W | 100 µg | ||
| MO-AB-53450W | Monoclonal | Marmoset | WB, ELISA | MO53450W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO00819CR |
| Specificity | This antibody binds to Yeast COX17. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | COX17 (COX17, Cytochrome C Oxidase Copper Chaperone) is a Protein Coding gene. Diseases associated with COX17 include Mitochondrial Metabolism Disease. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and AMPK Enzyme Complex Pathway. Gene Ontology (GO) annotations related to this gene include copper ion binding and copper chaperone activity. |
| Product Overview | Mouse Anti-Yeast COX17 Antibody is a mouse antibody against COX17. It can be used for COX17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome c oxidase copper chaperone; COX17; YLL009C |
| UniProt ID | Q12287 |
| Protein Refseq | The length of the protein is 69 amino acids long. The sequence is show below: MTETDKKQEQENHAECEDKPKPCCVCKPEKEERDTCILFNGQDSEKCKEFIEKYKECMKGYGFEVPSAN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry