Mouse Anti-Cox6B Antibody (CBMOAB-13815FYA)


Cat: CBMOAB-13815FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-13815FYA Monoclonal Fruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus) WB, ELISA MO13815FYA 100 µg
MO-AB-07694Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07694Y 100 µg
MO-AB-24830R Monoclonal Pig (Sus scrofa) WB, ELISA MO24830R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus)
CloneMO13815FYA
SpecificityThis antibody binds to fruit fly Cox6B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Cox6B Antibody is a mouse antibody against Cox6B. It can be used for Cox6B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG14235-PA, isoform A; COX6B; CoVIb
UniProt IDQ9VWD1
Protein RefseqThe length of the protein is 96 amino acids long.
The sequence is show below: MQFFMSKNKSSDKSSDSSNMSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQKVYKSMCPNAWVEKWDDQRESGTFPGRI.
For Research Use Only | Not For Clinical Use.
Online Inquiry