AibGenesis™ Mouse Anti-COX7A2L Antibody (CBMOAB-39767FYA)


Cat: CBMOAB-39767FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39767FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO39767FYA 100 µg
MO-AB-02607H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02607C 100 µg
MO-AB-10643R Monoclonal Cattle (Bos taurus) WB, ELISA MO10643R 100 µg
MO-AB-25020H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25020C 100 µg
MO-AB-26788W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26788W 100 µg
MO-AB-44174W Monoclonal Horse (Equus caballus) WB, ELISA MO44174W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO39767FYA
SpecificityThis antibody binds to Rhesus COX7A2L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus COX7A2L Antibody is a mouse antibody against COX7A2L. It can be used for COX7A2L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 7A-related protein, mitochondrial; COX7A2L
UniProt IDH9FCJ1
Protein RefseqThe length of the protein is 111 amino acids long.
The sequence is show below: KFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNRVPELQKFFQKADGVPIYLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPKNK.
For Research Use Only | Not For Clinical Use.
Online Inquiry