Mouse Anti-Cox7C Antibody (CBMOAB-13818FYA)
Cat: CBMOAB-13818FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-13818FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO13818FYA | 100 µg | ||
| CBMOAB-71411FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71411FYA | 100 µg | ||
| MO-AB-02609H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02609C | 100 µg | ||
| MO-AB-10645R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10645R | 100 µg | ||
| MO-AB-19819W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19819W | 100 µg | ||
| MO-AB-25022H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25022C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO13818FYA |
| Specificity | This antibody binds to fruit fly Cox7C. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | COX7C (Cytochrome C Oxidase Subunit 7C) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and Gene Expression. Gene Ontology (GO) annotations related to this gene include cytochrome-c oxidase activity. |
| Product Overview | Mouse Anti-D. melanogaster Cox7C Antibody is a mouse antibody against Cox7C. It can be used for Cox7C detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CG2249, isoform A; EC 1.9.3.1; CG2249, isoform B; EC 1.9.3.1; LD14731p; COX7C; CoVIIc |
| UniProt ID | Q7JW00 |
| Protein Refseq | The length of the protein is 66 amino acids long. The sequence is show below: MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry