Mouse Anti-Cox7C Antibody (CBMOAB-13818FYA)
Cat: CBMOAB-13818FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-13818FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO13818FYA | 100 µg | ||
CBMOAB-71411FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO71411FYA | 100 µg | ||
MO-AB-02609H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02609C | 100 µg | ||
MO-AB-10645R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10645R | 100 µg | ||
MO-AB-19819W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19819W | 100 µg | ||
MO-AB-25022H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25022C | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
Clone | MO13818FYA |
Specificity | This antibody binds to fruit fly Cox7C. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Mitochondrion; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-D. melanogaster Cox7C Antibody is a mouse antibody against Cox7C. It can be used for Cox7C detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CG2249, isoform A; EC 1.9.3.1; CG2249, isoform B; EC 1.9.3.1; LD14731p; COX7C; CoVIIc |
UniProt ID | Q7JW00 |
Protein Refseq | The length of the protein is 66 amino acids long. The sequence is show below: MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry