AibGenesis™ Mouse Anti-cox8b Antibody (CBMOAB-71413FYA)
Cat: CBMOAB-71413FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-71413FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO71413FYA | 100 µg | ||
| MO-AB-07695Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07695Y | 100 µg | ||
| MO-AB-10647R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10647R | 100 µg | ||
| MO-AB-25025H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25025C | 100 µg | ||
| MO-AB-29881W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29881W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
| Clone | MO71413FYA |
| Specificity | This antibody binds to Zebrafish cox8b. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Zebrafish cox8b Antibody is a mouse antibody against cox8b. It can be used for cox8b detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | cox8b |
| UniProt ID | X1WER9 |
| Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MSGFNRSFTLLRAAMRHQLIPKANITAKPAKHALSAGEQVIALSVMFVTILGPSGWILSHLEDYKHRPGAAQE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry