AibGenesis™ Mouse Anti-CPLANE2 Antibody (MO-AB-13413W)


Cat: MO-AB-13413W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13413W Monoclonal Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO13413W 100 µg
MO-AB-25039H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25039C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO13413W
SpecificityThis antibody binds to Chimpanzee CPLANE2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee CPLANE2 Antibody is a mouse antibody against CPLANE2. It can be used for CPLANE2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesREM2 and RAB-like small GTPase 1; RSG1
UniProt IDH2PY49
Protein RefseqThe length of the protein is 258 amino acids long.
The sequence is show below: MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLPPPVSIDTASYKIFVSGKSGVGKTALVAKLAGLEVPVVHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLPACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE.
For Research Use Only | Not For Clinical Use.
Online Inquiry