Mouse Anti-CPOX Antibody (CBMOAB-39818FYA)


Cat: CBMOAB-39818FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39818FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO39818FYA 100 µg
CBMOAB-71494FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71494FYA 100 µg
MO-AB-12664W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12664W 100 µg
MO-AB-53486W Monoclonal Marmoset WB, ELISA MO53486W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO39818FYA
SpecificityThis antibody binds to Rhesus CPOX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCPOX (Coproporphyrinogen Oxidase) is a Protein Coding gene. Diseases associated with CPOX include Coproporphyria, Hereditary and Porphyria Cutanea Tarda. Among its related pathways are Porphyrin and chlorophyll metabolism and Metabolism. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and structural constituent of eye lens.
Product OverviewMouse Anti-Rhesus CPOX Antibody is a mouse antibody against CPOX. It can be used for CPOX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCPOX
UniProt IDF7GNW9
Protein RefseqThe length of the protein is 453 amino acids long.
The sequence is show below: MALQLGRLSVGPCWRVARGGCRGLRAWSQCGGGGLRASSQHSAARRICRPPGPAGTEQSRGLGHGPTARGGPWLGTGLAAALAGLVGLAAAALGHVQRAEMVPKSSGTRAPSLGRPEEEDELARRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGASFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTLKEACDQHGPELYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEVFRFVQSCAKAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMSLPLTARWEYMHSPSENSKEAEILEVLRHPRDWVC.
For Research Use Only | Not For Clinical Use.
Online Inquiry