AibGenesis™ Mouse Anti-Cpx Antibody (CBMOAB-14067FYA)


Cat: CBMOAB-14067FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-14067FYA Monoclonal Fruit fly (Drosophila melanogaster), Rice (Oryza) WB, ELISA MO14067FYA 100 µg
Inquiry
CBMOAB-22334FYB Monoclonal Rice (Oryza) WB, ELISA MO22334FYB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Rice (Oryza)
CloneMO14067FYA
SpecificityThis antibody binds to fruit fly Cpx.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in the heme and chlorophyll biosynthesis. Catalyzes the aerobic oxidative decarboxylation of propionate groups of rings A and B of coproporphyrinogen-III to yield the vinyl groups in protoporphyrinogen-IX. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Cpx Antibody is a mouse antibody against Cpx. It can be used for Cpx detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesComplexin, isoform S; cpx
UniProt IDE1JJ32
Protein RefseqThe length of the protein is 146 amino acids long.
The sequence is show below: MAAFIAKQMVGNQLSAVKDAAGGAVGGDGGDDGDDKEKAEEEERERQEAIKEAEDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEAEQEELDDFTKLKNQIETQVNELKTQIEGKCVMQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry