AibGenesis™ Mouse Anti-Cralbp Antibody (CBMOAB-14103FYA)


Cat: CBMOAB-14103FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-14103FYA Monoclonal Fruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti) WB, ELISA MO14103FYA 100 µg
MO-AB-04975Y Monoclonal A. aegpti (Aedes aegpti) WB, ELISA MO04975Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. aegpti (Aedes aegpti)
CloneMO14103FYA
SpecificityThis antibody binds to fruit fly Cralbp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Cralbp Antibody is a mouse antibody against Cralbp. It can be used for Cralbp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCellular retinaldehyde binding protein; Cralbp
UniProt IDQ9VRP8
Protein RefseqThe length of the protein is 324 amino acids long.
The sequence is show below: MVQDQGETTGLPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGKVPMREMIELWKQELATKRDLILGLDKSILRSDRGIQRRSSFNAGKASTGGPNFVSQIESIEGSFRKLEFD.
For Research Use Only | Not For Clinical Use.
Online Inquiry