Mouse Anti-CRBP1 Antibody (MO-AB-24862R)


Cat: MO-AB-24862R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24862R Monoclonal Pig (Sus scrofa), Goat (Capra hircus) WB, ELISA MO24862R 100 µg
MO-AB-36975W Monoclonal Goat (Capra hircus) WB, ELISA MO36975W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Goat (Capra hircus)
CloneMO24862R
SpecificityThis antibody binds to Pig CRBP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against CRBP1. It can be used for CRBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCellular retinol binding protein 1; CRBP1
UniProt IDQ53J08
Protein RefseqThe length of the protein is 135 amino acids long.
The sequence is show below: MPVDFTGYWKMLANENFEEYLRALDVNVALRKIANLLKPDKEIVQDGNHMIIRTLSTFRNYIMDFEVGKEFEEDLTGIDDRKCMTTVSWDGDKLECVQKGEKEGRGWTQWIEGDELHLEMRVQGVACKQVFKKVN.
For Research Use Only | Not For Clinical Use.
Online Inquiry