Mouse Anti-CREB2 Antibody (MO-AB-24874R)


Cat: MO-AB-24874R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-24874R Monoclonal Pig (Sus scrofa), Silkworm (Bombyx mori) WB, ELISA MO24874R 100 µg
MO-AB-69546W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO69546W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa), Silkworm (Bombyx mori)
CloneMO24874R
SpecificityThis antibody binds to Pig CREB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against CREB2. It can be used for CREB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamescAMP response element-binding protein 2; CREB2
UniProt IDB2LVG7
Protein RefseqThe length of the protein is 348 amino acids long.
The sequence is show below: MAEMSFLSSEVLVGDLMSPFDPSGLGAEESLGLLDEYLEVAKHFKPHGFSGDKAKAGSSEWLAVDGLVSASDNSKEDAFSGTDWMVEKMDLKEFDFDALSGIDDLETMPDELLATLDDTCDLFDPPLQEPPQIVNPIGHLPESLPTTDQVAPFTFLQTLPLSPGALSSTPDNSFSLEIQGEVEISEGDRKPDSTTYITLIPQCIKEEDAPSDNDSVICMSPDSYLGSPQHSPSTSRASPSRSLLSPGAPCGSVRPKPYDPPGEKVVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRAP.
For Research Use Only | Not For Clinical Use.
Online Inquiry