AibGenesis™ Mouse Anti-CRIP3 Antibody (CBMOAB-39898FYA)


Cat: CBMOAB-39898FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39898FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO39898FYA 100 µg
MO-AB-10737R Monoclonal Cattle (Bos taurus) WB, ELISA MO10737R 100 µg
MO-AB-25075H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25075C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO39898FYA
SpecificityThis antibody binds to Rhesus CRIP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CRIP3 Antibody is a mouse antibody against CRIP3. It can be used for CRIP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCRIP3
UniProt IDF7G7L0
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: MSWTCPRCQQPVFFAEKVSSLGKNWHRFCLKCERCHSVLSPGGHAEHNGRPYCHKPCYGALFGPRGVNIGGVGSYLYNAPTPSPGSTTSLSPSSFSPPRPRTGLPQGKKSPPHMKTFTGETSLCPGCGEPVYFAEKVMSLGRNWHRPCLRCQRCRKTLTAGSHAEHDGVPYCHVPCYGYLFGPKGGQPHSRHWPKLWHVHGLWGCVDSFPCG.
For Research Use Only | Not For Clinical Use.
Online Inquiry