Mouse Anti-CRYBB2 Antibody (CBMOAB-39937FYA)


Cat: CBMOAB-39937FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39937FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish, Zebrafish (Danio rerio) WB, ELISA MO39937FYA 100 µg
CBMOAB-71858FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO71858FYA 100 µg
MO-AB-01441Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01441Y 100 µg
MO-AB-02668H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02668C 100 µg
MO-AB-07710Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07710Y 100 µg
MO-AB-10770R Monoclonal Cattle (Bos taurus) WB, ELISA MO10770R 100 µg
MO-AB-25113H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25113C 100 µg
MO-AB-29915W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29915W 100 µg
MO-AB-41471W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41471W 100 µg
MO-AB-53592W Monoclonal Marmoset WB, ELISA MO53592W 100 µg
MOFAB-494W Monoclonal Zebrafish WB, IHC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish, Zebrafish (Danio rerio)
CloneMO39937FYA
SpecificityThis antibody binds to Rhesus CRYBB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCRYBB2 (Crystallin Beta B2) is a Protein Coding gene. Diseases associated with CRYBB2 include Cataract 3, Multiple Types and Cerulean Cataract. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and structural molecule activity. An important paralog of this gene is CRYBB3.
Product OverviewMouse Anti-Rhesus CRYBB2 Antibody is a mouse antibody against CRYBB2. It can be used for CRYBB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCRYBB2
UniProt IDF7FCM9
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: MASDHQTQAGKPQSLNPKIIIFEQENFQGHSHELSGPCPNLKETGVEKAGSVLVQAGPWVGYEQANCKGEQFVFEKGEYPRWDSWTSSRRTDSLSSLRPIKVDSQEHKIILYENPNFTGKKMEIIDDDVPSFHAHGYQEKVSSVRVQSGTWVGYQYPGYRGLQYLLEKGDYKESSDFGAPHPQVQSVRRIRDMQWHQRGAFHPSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry