Mouse Anti-CSF1 Antibody (MO-AB-01768W)
Cat: MO-AB-01768W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-01768W | Monoclonal | Rhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Yeast | WB, ELISA | MO01768W | 100 µg | ||
| CBMOAB-00863CR | Monoclonal | Yeast | WB, ELISA | MO00863CR | 100 µg | ||
| MO-AB-02684H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02684C | 100 µg | ||
| MO-AB-25134H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25134C | 100 µg | ||
| MO-AB-01449Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01449Y | 100 µg | ||
| MO-AB-11084Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11084Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chicken (Gallus gallus), Frog (Xenopus laevis), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Yeast |
| Clone | MO01768W |
| Specificity | This antibody binds to Rhesus CSF1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development. Required for normal male and female fertility. Promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. Plays a role in lipoprotein clearance. |
| Product Overview | Mouse Anti-Rhesus CSF1 Antibody is a mouse antibody against CSF1. It can be used for CSF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Macrophage colony-stimulating factor 1 isoform c; CSF1 |
| UniProt ID | H9FQ89 |
| Protein Refseq | The length of the protein is 257 amino acids long. The sequence is show below: MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSGQGHERQREGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRRRRRSRQEPQRADSPLEQPEGSPLTQDEDRQVELPV. |
See other products for " CSF1 "
| MO-AB-10795R | Mouse Anti-CSF1 Antibody (MO-AB-10795R) |
| CBMOAB-39954FYA | Mouse Anti-CSF1 Antibody (CBMOAB-39954FYA) |
| MO-AB-25166W | Mouse Anti-CSF1 Antibody (MO-AB-25166W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry