Mouse Anti-CTSK Antibody (CBMOAB-40096FYA)
Cat: CBMOAB-40096FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40096FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus, Pig, Zebrafish (Danio rerio) | WB, ELISA | MO40096FYA | 100 µg | ||
| CBMOAB-72218FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO72218FYA | 100 µg | ||
| MO-AB-26494W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26494W | 100 µg | ||
| MO-AB-29943W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29943W | 100 µg | ||
| MO-AB-53723W | Monoclonal | Marmoset | WB, ELISA | MO53723W | 100 µg | ||
| MO-AB-10932R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10932R | 100 µg | ||
| MO-AB-24976R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24976R | 100 µg | ||
| MO-AB-02742H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02742C | 100 µg | ||
| MO-AB-07743Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07743Y | 100 µg | ||
| MOFY-0722-FY45 | Monoclonal | Rhesus, Human, Mouse, Rat | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY172 | Polyclonal | Dog, Human, Mouse, Rat | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY435 | Polyclonal | Rhesus, Human, Mouse, Rat, Pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY437 | Polyclonal | Rhesus | WB, IHC, ICC, IF | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus, Pig, Zebrafish (Danio rerio) |
| Clone | MO40096FYA |
| Specificity | This antibody binds to Rhesus CTSK. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CTSK (Cathepsin K) is a Protein Coding gene. Diseases associated with CTSK include Pycnodysostosis and Endosteal Hyperostosis, Autosomal Dominant. Among its related pathways are RANK Signaling in Osteoclasts and Innate Immune System. Gene Ontology (GO) annotations related to this gene include cysteine-type endopeptidase activity and collagen binding. An important paralog of this gene is CTSS. |
| Product Overview | Mouse Anti-Rhesus CTSK Antibody is a mouse antibody against CTSK. It can be used for CTSK detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cathepsin K; CTSK |
| UniProt ID | F7BLU2 |
| Protein Refseq | The length of the protein is 258 amino acids long. The sequence is show below: MHKENEEIENVSENRKHCHIFPCPLLTRSGKVPEFRQEREKCLEEMIRKQNLDGNLSFVMWGLKVLLLPVMSFALYPEEILDTHWELWKKTHRKQYNSKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTNEEVVQKMTGLKVPASHSRSNDTLYIPDWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSED. |
See other products for " CTSK "
For Research Use Only | Not For Clinical Use.
Online Inquiry