Mouse Anti-Cucumber Act2 Antibody (MO-AB-28231W)


Cat: MO-AB-28231W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCucumber (Cucumis sativus)
CloneMO28231W
SpecificityThis antibody binds to Cucumber Act2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActin exists as a ubiquitous protein and participates in the formation of filaments that make up most of the cytoskeleton. Actin filaments interact with myosin to help muscle contraction and help cell movement and cytokinesis. There are three sets of actin isoforms in vertebrates: alpha, beta, and gamma. Alpha-actin is present in muscle tissue and is the main component of the contractile device.
Product OverviewMouse Anti-Cucumber Act2 Antibody is a mouse antibody against Act2. It can be used for Act2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin; Act2
UniProt IDQ3YJS1
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: EKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDMKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEDAGIHETTYNSIMECDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGG.
For Research Use Only | Not For Clinical Use.
Online Inquiry