Mouse Anti-Cucumber rpl10 Antibody (MO-AB-28638W)


Cat: MO-AB-28638W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCucumber (Cucumis sativus)
CloneMO28638W
SpecificityThis antibody binds to Cucumber rpl10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a ribosomal protein that is a component of the 60S ribosome subunit. The related protein in chicken can bind to c-Jun and can repress c-Jun-mediated transcriptional activation. Some studies have detected an association between variation in this gene and autism spectrum disorders, though others do not detect this relationship. There are multiple pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Cucumber rpl10 Antibody is a mouse antibody against rpl10. It can be used for rpl10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal protein L10; rpl10
UniProt IDG3EIX9
Protein RefseqThe length of the protein is 163 amino acids long.
The sequence is show below: MPFGISLLRRESLRRLILSGEERSPEILISFHSSGSTSKQWRKLKNPWFPGRTRTPFRPSSCSTGKKKGFFAQLAHSAGPTCILYLSEEGSDRLEFLPSSDSMDQDLLSLYGQYRSTLVDHMDVEKASDLNECSRSLFHFYLPSSYLSFVCSREEFDLGIPPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry