AibGenesis™ Mouse Anti-CXCL5 Antibody (CBMOAB-40158FYA)


Cat: CBMOAB-40158FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40158FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO40158FYA 100 µg
MO-AB-07754Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07754Y 100 µg
MO-AB-24132W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24132W 100 µg
MO-AB-25220H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25220C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO40158FYA
SpecificityThis antibody binds to Rhesus CXCL5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CXCL5 Antibody is a mouse antibody against CXCL5. It can be used for CXCL5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesC-X-C motif chemokine; CXCL5
UniProt IDH9H4U5
Protein RefseqThe length of the protein is 114 amino acids long.
The sequence is show below: MSLLSSRAAPVPGPLGSLCSLLVLLLLLTPPGPLSPAGPVAAALRELRCSCLQTTQGVQPQMISNLQVFAIGPQCSEVEVVASLKNGTEVCLDPQAPFLKKVIQKILDGENKDN.
For Research Use Only | Not For Clinical Use.
Online Inquiry