AibGenesis™ Mouse Anti-CXCL9 Antibody (CBMOAB-40159FYA)


Cat: CBMOAB-40159FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40159FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO40159FYA 100 µg
MO-AB-08612W Monoclonal Cat (Felis catus) WB, ELISA MO08612W 100 µg
MO-AB-19198W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19198W 100 µg
MO-AB-34644W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34644W 100 µg
MO-AB-38515W Monoclonal Gorilla WB, ELISA MO38515W 100 µg
MO-AB-53771W Monoclonal Marmoset WB, ELISA MO53771W 100 µg
MO-AB-10976R Monoclonal Cattle (Bos taurus) WB, ELISA MO10976R 100 µg
MO-AB-24993R Monoclonal Pig (Sus scrofa) WB, ELISA MO24993R 100 µg
MO-AB-25222H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25222C 100 µg
MO-AB-00282L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00282L 100 µg
MO-AB-07756Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07756Y 100 µg
MO-AB-14786Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14786Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO40159FYA
SpecificityThis antibody binds to Rhesus CXCL9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CXCL9 Antibody is a mouse antibody against CXCL9. It can be used for CXCL9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCXCL9
UniProt IDF7HL04
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: MKKSGVLFLLGIIFLVLIGVQGTPVMRKGRCSCINTNQGTIHLQSLKDLKQFAPNLSCEKTEIIATLKNGDQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRPQQKKTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry