Mouse Anti-CXCL9 Antibody (CBMOAB-40159FYA)
Cat: CBMOAB-40159FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40159FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO40159FYA | 100 µg | ||
| MO-AB-08612W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08612W | 100 µg | ||
| MO-AB-19198W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO19198W | 100 µg | ||
| MO-AB-34644W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34644W | 100 µg | ||
| MO-AB-38515W | Monoclonal | Gorilla | WB, ELISA | MO38515W | 100 µg | ||
| MO-AB-53771W | Monoclonal | Marmoset | WB, ELISA | MO53771W | 100 µg | ||
| MO-AB-10976R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10976R | 100 µg | ||
| MO-AB-24993R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24993R | 100 µg | ||
| MO-AB-25222H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25222C | 100 µg | ||
| MO-AB-00282L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00282L | 100 µg | ||
| MO-AB-07756Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07756Y | 100 µg | ||
| MO-AB-14786Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14786Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO40159FYA |
| Specificity | This antibody binds to Rhesus CXCL9. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CXCL9 (C-X-C Motif Chemokine Ligand 9) is a Protein Coding gene. Diseases associated with CXCL9 include Endotheliitis and Sydenham Chorea. Among its related pathways are PEDF Induced Signaling and Akt Signaling. Gene Ontology (GO) annotations related to this gene include cytokine activity and CXCR3 chemokine receptor binding. An important paralog of this gene is CXCL10. |
| Product Overview | Mouse Anti-Rhesus CXCL9 Antibody is a mouse antibody against CXCL9. It can be used for CXCL9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | CXCL9 |
| UniProt ID | F7HL04 |
| Protein Refseq | The length of the protein is 125 amino acids long. The sequence is show below: MKKSGVLFLLGIIFLVLIGVQGTPVMRKGRCSCINTNQGTIHLQSLKDLKQFAPNLSCEKTEIIATLKNGDQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRPQQKKTA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry