AibGenesis™ Mouse Anti-CYB561 Antibody (CBMOAB-40194FYA)


Cat: CBMOAB-40194FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40194FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO40194FYA 100 µg
CBMOAB-72516FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72516FYA 100 µg
MO-AB-02770H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02770C 100 µg
MO-AB-10994R Monoclonal Cattle (Bos taurus) WB, ELISA MO10994R 100 µg
MO-AB-16024W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16024W 100 µg
MO-AB-24997R Monoclonal Pig (Sus scrofa) WB, ELISA MO24997R 100 µg
MO-AB-25225H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25225C 100 µg
MO-AB-53789W Monoclonal Marmoset WB, ELISA MO53789W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO40194FYA
SpecificityThis antibody binds to Rhesus CYB561.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CYB561 Antibody is a mouse antibody against CYB561. It can be used for CYB561 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYB561
UniProt IDF6Z3B3
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MEGGAAASTPAALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIGLVFLQGDALLVYRVFRNEAKRTTKVLDGLLHVFALVIALVGLVAVFDYHRKKGYADLYSLHSWCGILVFVLYFVQWLVGFSFFLFPGAPFSLRSRYRPQHIFFGATIFLLSVGTALLGLKEALLFNLGDKYSAFEPEGVLANVLGLLLACFGGSVLYILTRADWKRPSQAEEQALSMDFKTLTEGDSPGSQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry