AibGenesis™ Mouse Anti-cyb561a3 Antibody (CBMOAB-72517FYA)


Cat: CBMOAB-72517FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-72517FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO72517FYA 100 µg
MO-AB-10995R Monoclonal Cattle (Bos taurus) WB, ELISA MO10995R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO72517FYA
SpecificityThis antibody binds to Zebrafish cyb561a3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Other locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cyb561a3 Antibody is a mouse antibody against cyb561a3. It can be used for cyb561a3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b ascorbate-dependent protein 3; EC 1.-.-.-; Cytochrome b561 family member A3; cyb561a3; cybasc
UniProt IDA3KPR5
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MRGIVGFYITYLLCLILGIACVVLVVHWNFMYRDGFAWDGSSKNFNWHPVLMVTGMLVLYGNAAVVYRIPLTWGHNKLPWKLLHAGLLLLSFIFSVIGLCAVFNFHNVHHTANLYSLHSWVGICTAALFTAQWVMGFTSFLLPCTPMAVRAFVKPTHVWMGAMILVLSIVSCISGINEKLFFVLKETTNGTKPYSALPPEAVAANSLGVIIVAFGLVVLKILSNQMWQRPEPGDDEGVYRPLAYDGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry