Mouse Anti-CYB561D2 Antibody (CBMOAB-40195FYA)


Cat: CBMOAB-40195FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40195FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO40195FYA 100 µg
CBMOAB-72523FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72523FYA 100 µg
MO-AB-02772H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02772C 100 µg
MO-AB-10997R Monoclonal Cattle (Bos taurus) WB, ELISA MO10997R 100 µg
MO-AB-12695W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12695W 100 µg
MO-AB-25226H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25226C 100 µg
MO-AB-53792W Monoclonal Marmoset WB, ELISA MO53792W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO40195FYA
SpecificityThis antibody binds to Rhesus CYB561D2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CYB561D2 Antibody is a mouse antibody against CYB561D2. It can be used for CYB561D2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b561 domain-containing protein 2; CYB561D2
UniProt IDH9EZG8
Protein RefseqThe length of the protein is 132 amino acids long.
The sequence is show below: MALSAETESHIYRALRTASGAAAHLVALGFTIFVAVLARPGSSLFSWHPVLMSLAFSFLMTEALLVFSPESSLLRSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHLATRHGQAGLLAVLWAG.
For Research Use Only | Not For Clinical Use.
Online Inquiry