Mouse Anti-CYBRD1 Antibody (CBMOAB-40205FYA)


Cat: CBMOAB-40205FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40205FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO40205FYA 100 µg
CBMOAB-72543FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72543FYA 100 µg
MO-AB-12775W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12775W 100 µg
MO-AB-25000R Monoclonal Pig (Sus scrofa) WB, ELISA MO25000R 100 µg
MO-AB-53804W Monoclonal Marmoset WB, ELISA MO53804W 100 µg
MO-DKB-01514W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB, Single-Cell Western 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO40205FYA
SpecificityThis antibody binds to Rhesus CYBRD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYBRD1 (Cytochrome B Reductase 1) is a Protein Coding gene. Diseases associated with CYBRD1 include Hemochromatosis, Type 1 and Iron Metabolism Disease. Among its related pathways are Insulin receptor recycling and Mineral absorption. Gene Ontology (GO) annotations related to this gene include ferric-chelate reductase activity and oxidoreductase activity, oxidizing metal ions. An important paralog of this gene is CYB561A3.
Product OverviewMouse Anti-Rhesus CYBRD1 Antibody is a mouse antibody against CYBRD1. It can be used for CYBRD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYBRD1
UniProt IDF7F7W5
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MAMEGYWRFLALLGSALLVGFLSVIFTLVWVLHYREGLGWDGSALEFNWHPVLVVTGFVFIQGIASFRFFHLSASMGSAFSPSISHAHTCLFWTCHLWNSDCNGTYGSDRETNFFPEKSCIQYLPTRRCFRKYAWPSDPGVRGPHFLDSHQTAMETS.
For Research Use Only | Not For Clinical Use.
Online Inquiry