Mouse Anti-Cyld Antibody (CBMOAB-14326FYA)


Cat: CBMOAB-14326FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-14326FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO14326FYA 100 µg
CBMOAB-40216FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO40216FYA 100 µg
MO-AB-11021R Monoclonal Cattle (Bos taurus) WB, ELISA MO11021R 100 µg
MO-AB-24659W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24659W 100 µg
MO-AB-25002R Monoclonal Pig (Sus scrofa) WB, ELISA MO25002R 100 µg
MO-AB-53821W Monoclonal Marmoset WB, ELISA MO53821W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO14326FYA
SpecificityThis antibody binds to fruit fly Cyld.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYLD (CYLD Lysine 63 Deubiquitinase) is a Protein Coding gene. Diseases associated with CYLD include Cylindromatosis, Familial and Brooke-Spiegler Syndrome. Among its related pathways are Metabolism of proteins and Innate Immune System. Gene Ontology (GO) annotations related to this gene include protein kinase binding and thiol-dependent ubiquitin-specific protease activity.
Product OverviewMouse Anti-D. melanogaster Cyld Antibody is a mouse antibody against Cyld. It can be used for Cyld detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRE64280p; CYLD
UniProt IDQ8SYF0
Protein RefseqThe length of the protein is 639 amino acids long.
The sequence is show below: MNSKSDYEAEKEKKLTITNRFGDSLENYELSNESEHKTHVYPKKIPNRKNGILKNTDANHSAVDNQHLEDVDLADILGTNWPKRAGPAAMILNNKSKTDPSNSVDLILKPASPILKIEPEEPLRFTIADYQPLIEIPGTELAIGSLVEVSNPGVCEDLYGVVRWIGIPPGPQKNVLVGIEVEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNSISANRVSSNHAKKFGVADCPAIYGSIPPLQIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSVFDSILYRRPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTCEEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSSDIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRDCFGSLQAGSGLECTAFCPKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMELFAVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWFSEEGARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMYH.
For Research Use Only | Not For Clinical Use.
Online Inquiry