Mouse Anti-CYP2A6 Antibody (CBMOAB-40243FYA)
Cat: CBMOAB-40243FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-40243FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO40243FYA | 100 µg | ||
MO-AB-11046R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11046R | 100 µg | ||
MO-AB-14805Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14805Y | 100 µg | ||
MO-AB-25037R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25037R | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Sheep (Ovis aries) |
Clone | MO40243FYA |
Specificity | This antibody binds to Rhesus CYP2A6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Rhesus CYP2A6 Antibody is a mouse antibody against CYP2A6. It can be used for CYP2A6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome P450, family 2, subfamily A, polypeptide 6; CYP2A6 |
UniProt ID | B6EY70 |
Protein Refseq | The length of the protein is 59 amino acids long. The sequence is show below: LYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNRHTLDPNSPRDFIDSFLIRMQE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry