Mouse Anti-CYP2A6 Antibody (CBMOAB-40243FYA)
Cat: CBMOAB-40243FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-40243FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO40243FYA | 100 µg | ||
| MO-AB-11046R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11046R | 100 µg | ||
| MO-AB-14805Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14805Y | 100 µg | ||
| MO-AB-25037R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25037R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Sheep (Ovis aries) |
| Clone | MO40243FYA |
| Specificity | This antibody binds to Rhesus CYP2A6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CYP2A6 (Cytochrome P450 Family 2 Subfamily A Member 6) is a Protein Coding gene. Diseases associated with CYP2A6 include Tobacco Addiction and Coumarin Resistance. Among its related pathways are superpathway of steroid hormone biosynthesis and superpathway of tryptophan utilization. Gene Ontology (GO) annotations related to this gene include enzyme binding and heme binding. An important paralog of this gene is CYP2A7. |
| Product Overview | Mouse Anti-Rhesus CYP2A6 Antibody is a mouse antibody against CYP2A6. It can be used for CYP2A6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome P450, family 2, subfamily A, polypeptide 6; CYP2A6 |
| UniProt ID | B6EY70 |
| Protein Refseq | The length of the protein is 59 amino acids long. The sequence is show below: LYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNRHTLDPNSPRDFIDSFLIRMQE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry