Mouse Anti-CYP2C18 Antibody (CBMOAB-40245FYA)


Cat: CBMOAB-40245FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40245FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Sheep (Ovis aries) WB, ELISA MO40245FYA 100 µg
MO-AB-11048R Monoclonal Cattle (Bos taurus) WB, ELISA MO11048R 100 µg
MO-AB-14806Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14806Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Sheep (Ovis aries)
CloneMO40245FYA
SpecificityThis antibody binds to Rhesus CYP2C18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CYP2C18 Antibody is a mouse antibody against CYP2C18. It can be used for CYP2C18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP2C18
UniProt IDF7H899
Protein RefseqThe length of the protein is 431 amino acids long.
The sequence is show below: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEKFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEALCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHNRFDYKDQRFLNLMEKFNENLRILSSPWIQEKHNLQSEFTIESLIATVTDMFGAGTETTSTTLRFGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLIPTNLPHAVTCDVKFRNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDRSGNFKKSDYFMPFSAGKRMCVGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry