Mouse Anti-CYP2C8 Antibody (CBMOAB-40250FYA)


Cat: CBMOAB-40250FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40250FYA Monoclonal Rhesus (Macaca mulatta), Human (Homo sapiens) WB, ELISA MO40250FYA 100 µg
MO-DKB-01209W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB, IF, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Human (Homo sapiens)
CloneMO40250FYA
SpecificityThis antibody binds to Rhesus CYP2C8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CYP2C8 Antibody is a mouse antibody against CYP2C8. It can be used for CYP2C8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP2C8
UniProt IDF7H678
Protein RefseqThe length of the protein is 393 amino acids long.
The sequence is show below: MDPFVVLVLCLSFVLLFSLWRQSSGRRKLPPGPTPLPIIGNILQIDVKDIGKSFSNFSKVYGPVFTVYFGMNPVVVLHGYETVKEALIDNAEEFSGRGILPISERITNGLGIISSNGKRWKETRRFSLTTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDENFLTLMKRFTVNFRILTSPWIQVCNNFPLLIDCFPGTHNKLLKNVALTKSYIRKKVKEHQATLDVNNPRDFIDCFLIKMEQEKDNQQSEFTIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVIHEIQRYIDLVPTGVPHAVTTDIKFRNYLIPKSFDNKIMLAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry