Mouse Anti-CYP2E1 Antibody (CBMOAB-40262FYA)
Cat: CBMOAB-40262FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-40262FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO40262FYA | 100 µg | ||
MO-AB-02805H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02805C | 100 µg | ||
MO-AB-07796W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07796W | 100 µg | ||
MO-AB-07801Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO07801Y | 100 µg | ||
MO-AB-11053R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11053R | 100 µg | ||
MO-AB-14810Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14810Y | 100 µg | ||
MO-AB-25050R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25050R | 100 µg | ||
MO-AB-25247H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25247C | 100 µg | ||
MO-AB-30017W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30017W | 100 µg | ||
MO-AB-53837W | Monoclonal | Marmoset | WB, ELISA | MO53837W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
Clone | MO40262FYA |
Specificity | This antibody binds to Rhesus CYP2E1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CYP2E1 (Cytochrome P450 Family 2 Subfamily E Member 1) is a Protein Coding gene. Diseases associated with CYP2E1 include Alcohol Abuse and Fatty Liver Disease. Among its related pathways are Caffeine Pathway, Pharmacokinetics and Acetaminophen Pathway (therapeutic doses), Pharmacokinetics. Gene Ontology (GO) annotations related to this gene include enzyme binding and iron ion binding. An important paralog of this gene is CYP2C9. |
Product Overview | Mouse Anti-Rhesus CYP2E1 Antibody is a mouse antibody against CYP2E1. It can be used for CYP2E1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome P450 2E1; CYP2E1 |
UniProt ID | H9F3W9 |
Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: LDESGKFKYSDYFKPFSAGKRVCAGEGLARMELFLLLSAILQHFNLKPLVDPKDIDISPVNIGFGCIPPRFKLCVIPRS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry