Mouse Anti-CYP2E1 Antibody (CBMOAB-40262FYA)


Cat: CBMOAB-40262FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40262FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO40262FYA 100 µg
MO-AB-02805H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02805C 100 µg
MO-AB-07796W Monoclonal Cat (Felis catus) WB, ELISA MO07796W 100 µg
MO-AB-07801Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07801Y 100 µg
MO-AB-11053R Monoclonal Cattle (Bos taurus) WB, ELISA MO11053R 100 µg
MO-AB-14810Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14810Y 100 µg
MO-AB-25050R Monoclonal Pig (Sus scrofa) WB, ELISA MO25050R 100 µg
MO-AB-25247H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25247C 100 µg
MO-AB-30017W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30017W 100 µg
MO-AB-53837W Monoclonal Marmoset WB, ELISA MO53837W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO40262FYA
SpecificityThis antibody binds to Rhesus CYP2E1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2E1 (Cytochrome P450 Family 2 Subfamily E Member 1) is a Protein Coding gene. Diseases associated with CYP2E1 include Alcohol Abuse and Fatty Liver Disease. Among its related pathways are Caffeine Pathway, Pharmacokinetics and Acetaminophen Pathway (therapeutic doses), Pharmacokinetics. Gene Ontology (GO) annotations related to this gene include enzyme binding and iron ion binding. An important paralog of this gene is CYP2C9.
Product OverviewMouse Anti-Rhesus CYP2E1 Antibody is a mouse antibody against CYP2E1. It can be used for CYP2E1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome P450 2E1; CYP2E1
UniProt IDH9F3W9
Protein RefseqThe length of the protein is 79 amino acids long.
The sequence is show below: LDESGKFKYSDYFKPFSAGKRVCAGEGLARMELFLLLSAILQHFNLKPLVDPKDIDISPVNIGFGCIPPRFKLCVIPRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry