Mouse Anti-CYP2U1 Antibody (CBMOAB-40272FYA)


Cat: CBMOAB-40272FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40272FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO40272FYA 100 µg
CBMOAB-72723FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72723FYA 100 µg
MO-AB-11057R Monoclonal Cattle (Bos taurus) WB, ELISA MO11057R 100 µg
MO-AB-24720W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24720W 100 µg
MO-AB-53839W Monoclonal Marmoset WB, ELISA MO53839W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO40272FYA
SpecificityThis antibody binds to Rhesus CYP2U1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP2U1 (Cytochrome P450 Family 2 Subfamily U Member 1) is a Protein Coding gene. Diseases associated with CYP2U1 include Spastic Paraplegia 56, Autosomal Recessive and Spastic Paraplegia 46, Autosomal Recessive. Among its related pathways are superpathway of tryptophan utilization and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP2R1.
Product OverviewMouse Anti-Rhesus CYP2U1 Antibody is a mouse antibody against CYP2U1. It can be used for CYP2U1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP2U1
UniProt IDF7DQF7
Protein RefseqThe length of the protein is 383 amino acids long.
The sequence is show below: GVVFAHYGPIWRQQRKFSHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQRFDYTNSEFKKMLGFMSRGLEICLNSQVLMVNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNSLLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLAIPHMTSGNTGKVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETFIPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPKDSKKPLLTGRFGLTLAPHPFNITISRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry