Mouse Anti-CYP3A43 Antibody (CBMOAB-40276FYA)


Cat: CBMOAB-40276FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-40276FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO40276FYA 100 µg
MO-AB-14989W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14989W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO40276FYA
SpecificityThis antibody binds to Rhesus CYP3A43.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYP3A43 (Cytochrome P450 Family 3 Subfamily A Member 43) is a Protein Coding gene. Among its related pathways are Metabolism and Cytochrome P450 - arranged by substrate type. Gene Ontology (GO) annotations related to this gene include iron ion binding and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is CYP3A5.
Product OverviewMouse Anti-Rhesus CYP3A43 Antibody is a mouse antibody against CYP3A43. It can be used for CYP3A43 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCYP3A43
UniProt IDF7A3W6
Protein RefseqThe length of the protein is 502 amino acids long.
The sequence is show below: MDLIPNFAMETWVLVATSLVLLYIYGTHSHKLFKKLGIPGPTPLPFLGTILFYLRGLWKFDRECNEKYGEMWGLYEGQQPMLVIMDPDMIKTVLVKECYSVFTNRMPLGPMGFMKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRREAENSKPTNLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLSISLFPFLTPVFEVLNIGLFPKDVTRFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETSHKALSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYLDIVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPERFSKKNKDSIDPYRYIPFGAGPRNCIGMRFALTNIKLAVIKALQNFSFEPCEETQLPLKLNNLPILQPENPIVLKVHLRDGITSGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry