Mouse Anti-D. melanogaster 5-Ht1B Antibody (CBMOAB-00349FYA)
Cat: CBMOAB-00349FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO00349FYA |
Specificity | This antibody binds to fruit fly 5-Ht1B. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins which inhibit adenylate cyclase. |
Product Overview | Mouse Anti-D. melanogaster 5-Ht1B Antibody is a mouse antibody against 5-Ht1B. It can be used for 5-Ht1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CG30126; 5-HT1B |
UniProt ID | A1ZBG1 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: MFCSLRVKCLASTIKALYHPQQRQQHERQARQQQQQQQQKQQQQQQHQQQQQLRRQQHQKQQQQQNQQQAIRL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry