AibGenesis™ Mouse Anti-D. melanogaster Aay Antibody (CBMOAB-00483FYA)
Cat: CBMOAB-00483FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster) |
| Clone | MO00483FYA |
| Specificity | This antibody binds to fruit fly Aay. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Catalyzes the last step in the biosynthesis of serine from carbohydrates. The reaction mechanism proceeds via the formation of a phosphoryl-enzyme intermediates. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-D. melanogaster Aay Antibody is a mouse antibody against Aay. It can be used for Aay detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Aay protein; Fragment; aay |
| UniProt ID | Q9NFS2 |
| Protein Refseq | The length of the protein is 46 amino acids long. The sequence is show below: IGDGATDLEAVPPANYFIGFGGNVVRPEVYRRAQYYVTDFEQLMGQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry