Mouse Anti-D. melanogaster Akirin Antibody (CBMOAB-00797FYA)


Cat: CBMOAB-00797FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00797FYA
SpecificityThis antibody binds to fruit fly Akirin.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRequired for embryonic development and for normal innate immune response. Effector of immune deficiency pathway (Imd) acting either downstream of, or at the level of, the NF-kappa-B factor Relish (Rel). Not part of the Toll pathway (PubMed:18066067). NF-kappa-B factor Relish (Rel) cofactor that orchestrates NF-kappa-B factor Relish (Rel) transcriptional selectivity by recruiting the Osa-containing-SWI/SNF-like Brahma complex (BAP) through bap60 interaction, leading to activation a subset of NF-kappa-B factor Relish (Rel) effector genes (PubMed:25180232). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Akirin Antibody is a mouse antibody against Akirin. It can be used for Akirin detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAkirin, isoform C; Akirin, isoform D; Akirin, isoform E; Akirin, isoform F; akirin
UniProt IDM9MRW4
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MACATLKRALDWESMNQRPPKRRRCNPFGQAGSNAGPASPSRDGPSTSAGLPHTPSNRFAKDSTEPSPFSESSLAKMSPDKMAESLCNEIKRLHKRKQLPITSSALERMQDSESSGSEMGPESPRRPDSPQNLMRHGEKALFTFKQVQLICESMIKERENQLRERYESVLTTKLAEQYDAFVKFTYDQIQRRYEAAPSYLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry