Mouse Anti-D. melanogaster Alkb Antibody (CBMOAB-00874FYA)


Cat: CBMOAB-00874FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00874FYA
SpecificityThis antibody binds to fruit fly Alkb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDioxygenase that repairs alkylated DNA and RNA containing 3-methylcytosine or 1-methyladenine by oxidative demethylation. Has highest activity towards 3-methylcytosine. Has lower activity towards alkylated DNA containing ethenoadenine, and no detectable activity towards 1-methylguanine or 3-methylthymine. Accepts double-stranded and single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron. Provides extensive resistance to alkylating agents such as MMS and DMS (SN2 agents), but not to MMNG and MNU (SN1 agents).
Product OverviewMouse Anti-D. melanogaster Alkb Antibody is a mouse antibody against Alkb. It can be used for Alkb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG33250-PA; HDC19127; LD02396p; AlkB; CG33250-RA
UniProt IDQ7KUZ2
Protein RefseqThe length of the protein is 332 amino acids long.
The sequence is show below: MFKLVFKQYKCKSTSPDLTEVVKIDDCVVKGNDQEKSDNNIVQRLSISNVESLQTMPGVKSPKDWRTYTLTNHPGIIVIRNPFSERGRRYWSARCLRDFPRTPNIVNLNERLFDESVRSDWWKQLNLCSDGVEFQRIKSAMRWTTFGYHHNWDTKIYDEEMQSPFPEDLSSLCGLFAQALGYADFKPEAAIVNYYPVGSTLSGHTDHSEPNKSAPLFSFSFGQTAIFLIGGRSLEEKPTAIYLQSGDVMIMSGESRLCYHAVPRIIKTQASATLSLIIEDVDNADIKTRTIDKDLFHDVGNPQFWEPFSRYMDDSRININIRQVLNPGDVKL.
See other products for " alkB "
For Research Use Only | Not For Clinical Use.
Online Inquiry