Mouse Anti-D. melanogaster Atox1 Antibody (CBMOAB-02025FYA)


Cat: CBMOAB-02025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02025FYA
SpecificityThis antibody binds to fruit fly Atox1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome.
Product OverviewMouse Anti-D. melanogaster Atox1 Antibody is a mouse antibody against Atox1. It can be used for Atox1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAtox1, isoform B; Atox1
UniProt IDM9PD88
Protein RefseqThe length of the protein is 89 amino acids long.
The sequence is show below: MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGVKKXDEFLSKFQKYGRLKLEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry