Mouse Anti-D. melanogaster Atox1 Antibody (CBMOAB-02025FYA)
Cat: CBMOAB-02025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO02025FYA |
Specificity | This antibody binds to fruit fly Atox1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. |
Product Overview | Mouse Anti-D. melanogaster Atox1 Antibody is a mouse antibody against Atox1. It can be used for Atox1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Atox1, isoform B; Atox1 |
UniProt ID | M9PD88 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: MTVHEFKVEMTCGGCASAVERVLGKLGDKVEKVNINLEDRTVSVTSNLSSDELMEQLRKTGKSTTYVGVKKXDEFLSKFQKYGRLKLEV. |
See other products for " ATOX1 "
MO-AB-10686Y | Mouse Anti-O. mykiss ATOX1 Antibody (MO-AB-10686Y) |
MO-AB-07768R | Mouse Anti-Cattle ATOX1 Antibody (MO-AB-07768R) |
MO-AB-24222H | Mouse Anti-Rat Atox1 Antibody (MO-AB-24222H) |
CBMOAB-66972FYA | Mouse Anti-Zebrafish atox1 Antibody (CBMOAB-66972FYA) |
MO-AB-21556W | Mouse Anti-Chimpanzee ATOX1 Antibody (MO-AB-21556W) |
MO-AB-51497W | Mouse Anti-Marmoset ATOX1 Antibody (MO-AB-51497W) |
MO-AB-29076W | Mouse Anti-Dog ATOX1 Antibody (MO-AB-29076W) |
MO-AB-23929R | Mouse Anti-Pig ATOX1 Antibody (MO-AB-23929R) |
MO-AB-14285Y | Mouse Anti-Sheep ATOX1 Antibody (MO-AB-14285Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry