AibGenesis™ Mouse Anti-Bip1 Antibody (CBMOAB-02524FYA)


Cat: CBMOAB-02524FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-02524FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Maize (Zea mays) WB, ELISA MO02524FYA 100 µg
MO-AB-02265W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02265W 100 µg
MO-AB-47546W Monoclonal Maize (Zea mays) WB, ELISA MO47546W 100 µg
MO-DKB-03007W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Maize (Zea mays)
CloneMO02524FYA
SpecificityThis antibody binds to fruit fly Bip1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Bip1 Antibody is a mouse antibody against Bip1. It can be used for Bip1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBip1, isoform B; RE51928p; bip1; bip1-RA
UniProt IDC6SV53
Protein RefseqThe length of the protein is 327 amino acids long.
The sequence is show below: MAKTRIKMTPLRKSSSSKGIVLPINAAGGSVIAGALAGGGGAGTGSGAVKSAVASSTTIELVESPNRHQAKKPNTGIMPMPQRSHSISSSASSDVLSINSDYEASLPLSALEDSQNGLNRLENGQAKKRKLYVITEKSDETKGQTLETNGQPKKRKMFVVVEQDKDVAGKKLMIMADKPQTNLTQHLEKLLPELLNRIQDKEQKQIKPAPVVTKAKPVVNNPRPHITLPPKKNPTNFAKITSTPSSVPSSIQMPLPIQNTKILKSENSELTMNSDEIETNINLSPDFRFLMKILPKLEQLPEPHKQNVKRSIQIFVEKSYSIYGNKD.
For Research Use Only | Not For Clinical Use.
Online Inquiry