AibGenesis™ Mouse Anti-D. melanogaster Cg8335-Ra Antibody (CBMOAB-12502FYA)


Cat: CBMOAB-12502FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO12502FYA
SpecificityThis antibody binds to fruit fly Cg8335-Ra.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis of a specialized repertoire of mRNAs and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Cg8335-Ra Antibody is a mouse antibody against Cg8335-Ra. It can be used for Cg8335-Ra detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 3 subunit F; eIF3f; Eukaryotic translation initiation factor 3 subunit 5; CG8335-RA; eIF3-S5
UniProt IDH1UU98
Protein RefseqThe length of the protein is 286 amino acids long.
The sequence is show below: MMSRNFSMRAKVYLKPLVFFQIIDAYDRRPKGDNQVMGTLLGRNKEGHIEITNCFTVPHKEHSENKRIDLDMAYASEVLELNMFAYPNERVLGWFCTGKSVSRSASLIHDYYVRECCEGQPLHLLVDAALKNQRLSTRLYCAVEMGVPGGTKGLMFSLVPLEISNENSDLVALRCIEKQSQQQASKQMERFVPELAQVVDATRDMQHRLDLVLRYINDVLARKKKPDNVVGRSLYAALTAVPLLDSDKFRVMFNTNLRDMLMAITLSTMIKTQLEISEKLSCMQDQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry