AibGenesis™ Mouse Anti-Chic Antibody (CBMOAB-13341FYA)


Cat: CBMOAB-13341FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-13341FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO13341FYA 100 µg
MO-NAB-00747W Monoclonal D. melanogaster (Drosophila melanogaster) IF, IHC, WB NW0669 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO13341FYA
SpecificityThis antibody binds to fruit fly Chic.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Chic Antibody is a mouse antibody against Chic. It can be used for Chic detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProfilin; Protein chickadee; chic; chi
UniProt IDP25843
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY.
For Research Use Only | Not For Clinical Use.
Online Inquiry