Mouse Anti-Cid Antibody (CBMOAB-13542FYA)


Cat: CBMOAB-13542FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-13542FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO13542FYA 100 µg
MO-MMB-0683 Monoclonal Fruit fly (Drosophila melanogaster) IF M4F8 100 µg
MOMUB-00020W Monoclonal Fruit fly (Drosophila melanogaster) WB, IF NW0169 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO13542FYA
SpecificityThis antibody binds to fruit fly Cid.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore (PubMed:11483958, PubMed:16839185). Required for recruitment and assembly of kinetochore proteins, mitotic progression and chromosome segregation (PubMed:24703848, PubMed:11483958, PubMed:16839185). May serve as an epigenetic mark that propagates centromere identity through replication and cell division (PubMed:11483958, PubMed:16839185). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Cid Antibody is a mouse antibody against Cid. It can be used for Cid detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H3-like centromeric protein cid; CENP-A homolog; Centromere identifier protein; cid
UniProt IDQ9V6Q2
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MPRHSRAKRAPRPSANNSKSPNDDDTAFRSPEPEDGTDYGLEFTTSQLTLQDNNRRSSTLRRDAGRRQPAARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYICDRGRQF.
For Research Use Only | Not For Clinical Use.
Online Inquiry