AibGenesis™ Mouse Anti-D. melanogaster Dredd Antibody (CBMOAB-15154FYA)


Cat: CBMOAB-15154FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO15154FYA
SpecificityThis antibody binds to fruit fly Dredd.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionEffector of the programmed cell death (PCD) activators rpr, grim and hid (PubMed:9740659). May play an apoptotic role in the germline as well as soma. Fadd interacts with Dredd to promote cleavage of Dredd and is necessary and sufficient for enhancing Dredd-induced apoptosis (PubMed:10934188). Plays a role in the innate immune response. Required for resistance to Gram-negative bacterial infection (PubMed:11269502). Diap2-mediated ubiquitination of Dredd is critical for processing of imd and rel and the subsequent expression of antimicrobial genes such as DptA (PubMed:22549468). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Dredd Antibody is a mouse antibody against Dredd. It can be used for Dredd detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCaspase-8; EC 3.4.22.61; Death-related ced-3/NEDD2-like protein; [Cleaved into: Caspase-8 subunit p15; Caspase-8 subunit p10]; Dredd; DCP2
UniProt IDQ8IRY7
Protein RefseqThe length of the protein is 494 amino acids long.
The sequence is show below: MAGSNLLIHLDTIDQNDLIYVERDMNFAQKVGLCFLLYGDDHSDATYILQKLLAMTRSDFPQSDLLIKFAKSRPETWRRHLVEALCIIGARKVLRRLGFCWQELRMHYLPHIAGITLHVHPLLKSLYRMCEELSLVQSGRLLLDVREKVESQQAGDPLRFYDPAYLEIFLLDWLTRRSIKLGDINAAGSDVQLLVGHLKSNGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQEIESDNQQSYCSTQIDALKLTRENAGIALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHMGIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYKPKLLIIQACQEKLVHKKKPNELFRIDVTTVSPDQHIDMLRAMSTVNGYAALRHTQTGSWFIGSLCDAIDRRSASEHIADILTIVTNEVSKKRGSNDESMVPNVKSTFRQHVYFPPRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry