AibGenesis™ Mouse Anti-Dsx Antibody (CBMOAB-15322FYA)


Cat: CBMOAB-15322FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-15322FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Drosophila melanogaster WB, ELISA MO15322FYA 100 µg
MO-NAB-00773W Monoclonal D. melanogaster (Drosophila melanogaster) IF, IHC NW0695 100 µg
MOFY-1222-FY135 Polyclonal Drosophila melanogaster WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster), Drosophila melanogaster
CloneMO15322FYA
SpecificityThis antibody binds to fruit fly Dsx.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Dsx Antibody is a mouse antibody against Dsx. It can be used for Dsx detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein doublesex; dsx
UniProt IDP23023
Protein RefseqThe length of the protein is 549 amino acids long.
The sequence is show below: MVSEENWNSDTMSDSDMIDSKNDVCGGASSSSGSSISPRTPPNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRALHMHEVPPANPAATTLLSHHHHVAAPAHVHAHHVHAHHAHGGHHSHHGHVLHHQQAAAAAAAAPSAPASHLGGSSTAASSIHGHAHAHHVHMAAAAAASVAQHQHQSHPHSHHHHHQNHHQHPHQQPATQTALRSPPHSDHGGSVGPATSSSGGGAPSSSNAAAATSSNGSSGGGGGGGGGSSGGGAGGGRSSGTSVITSADHHMTTVPTPAQSLEGSCDSSSPSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKFRYPWELMPLMYVILKDADANIEEASRRIEEARVEINRTVAQIYYNYYTPMALVNGAPMYLTYPSIEQGRYGAHFTHLPLTQICPPTPEPLALSRSPSSPSGPSAVHNQKPSRPGSSNGTVHSAASPTMVTTMATTSSTPTLSRRQRSRSATPTTPPPPPPAHSSSNGAYHHGHHLVSSTAAT.
For Research Use Only | Not For Clinical Use.
Online Inquiry