AibGenesis™ Mouse Anti-D. melanogaster Esg Antibody (CBMOAB-16366FYA)


Cat: CBMOAB-16366FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO16366FYA
SpecificityThis antibody binds to fruit fly Esg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranscription factor that can both stimulate and repress transcription. Binds to the consensus DNA sequence 5'-A/GCAGGTG-3'. Regulates cell motility and adhesion during tracheal morphogenesis by stimulating transcription of the DE-cadherin gene shg at branch tips, thereby promoting tracheal tube fusion. Maintains diploidy in imaginal cells by inhibiting the transcription of genes required for endoreplication. Required for development of the genital disk and acts as an intrinsic determinant of wing cell fate. The somatic protein is required for maintenance of male germ cells. Acts with other members of the snail protein family to control embryonic central nervous system development. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Esg Antibody is a mouse antibody against Esg. It can be used for Esg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein escargot; Protein fleabag; esg; flg
UniProt IDP25932
Protein RefseqThe length of the protein is 470 amino acids long.
The sequence is show below: MHTVEDMLVEKNYSKCPLKKRPVNYQFEAPQNHSNTPNEPQDLCVKKMEILEENPSEELINVSDCCEDEGVDVDHTDDEHIEEEDEDVDVDVDSDPNQTQAAALAAAAAVAAAAAASVVVPTPTYPKYPWNNFHMSPYTAEFYRTINQQGHQILPLRGDLIAPSSPSDSLGSLSPPPHHYLHGRASSVSPPMRSEIIHRPIGVRQHRFLPYPQMPGYPSLGGYTHTHHHHAPISPAYSENSYYSMRSMTPESSCSSSLPEDLSLKHKNLNLNLNTSQPGEQAAAKTGDMSPETMPNASAKKDKNQPPRYQCPDCQKSYSTFSGLTKHQQFHCPAAEGNQVKKSFSCKDCDKTYVSLGALKMHIRTHTLPCKCNLCGKAFSRPWLLQGHIRTHTGEKPFSCQHCHRAFADRSNLRAHLQTHSDIKKYSCTSCSKTFSRMSLLTKHSEGGCPGGSAGSSSSSELNYAGYAEP.
For Research Use Only | Not For Clinical Use.
Online Inquiry