AibGenesis™ Mouse Anti-Fabp Antibody (CBMOAB-16507FYA)


Cat: CBMOAB-16507FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16507FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO16507FYA 100 µg
MO-AB-01823Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01823Y 100 µg
MO-AB-03432H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03432C 100 µg
MO-AB-15214Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15214Y 100 µg
MO-AB-23198H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23198C 100 µg
MO-AB-25733R Monoclonal Pig (Sus scrofa) WB, ELISA MO25733R 100 µg
MO-AB-30742W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30742W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO16507FYA
SpecificityThis antibody binds to fruit fly Fabp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Fabp Antibody is a mouse antibody against Fabp. It can be used for Fabp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG6783, isoform C; fabp
UniProt IDQ8INK3
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MSFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKPTTIVREFTDNELITLIPHLTPSQHGSLRLRVPCQPVPPTSVDDGARSGGCGQRPGGP.
For Research Use Only | Not For Clinical Use.
Online Inquiry