AibGenesis™ Mouse Anti-Fan Antibody (CBMOAB-16528FYA)


Cat: CBMOAB-16528FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16528FYA Monoclonal Fruit fly (Drosophila melanogaster), Soybean (Glycine max) WB, ELISA MO16528FYA 100 µg
MO-AB-31496H Monoclonal Soybean (Glycine max) WB, ELISA MO31496C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Soybean (Glycine max)
CloneMO16528FYA
SpecificityThis antibody binds to fruit fly Fan.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Fan Antibody is a mouse antibody against Fan. It can be used for Fan detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT11025p; CG7919-PA; Farinelli; fan
UniProt IDQ9VSD3
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MSDNTESKLALDPCDVIVFEGPFNRSVSRKLVIKNTSKTQRMAFKMKTTTPKLFYVRPNIGVLGPEQKVSVDIFMQPILQEQIKKRHKFLLLAAEVTGDISDVQEFWKMQNPNETRETKIKCELVPSKEDDFRQAGGSAVISTDNKDGEVHFDAQEVSEPMAKLLKQVSMLEDEHMALTDQIDGLRDQAIGRTFFYMAAIVIIILSAVAGAYYGKTRL.
For Research Use Only | Not For Clinical Use.
Online Inquiry