Mouse Anti-Fancl Antibody (CBMOAB-16532FYA)


Cat: CBMOAB-16532FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-16532FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) WB, ELISA MO16532FYA 100 µg
Inquiry
CBMOAB-42570FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42570FYA 100 µg
Inquiry
CBMOAB-59938FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59938FYC 100 µg
Inquiry
CBMOAB-76084FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO76084FYA 100 µg
Inquiry
MO-AB-01849Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01849Y 100 µg
Inquiry
MO-AB-03492H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03492C 100 µg
Inquiry
MO-AB-12363R Monoclonal Cattle (Bos taurus) WB, ELISA MO12363R 100 µg
Inquiry
MO-AB-55247W Monoclonal Marmoset WB, ELISA MO55247W 100 µg
Inquiry
MO-AB-69795W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO69795W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio)
CloneMO16532FYA
SpecificityThis antibody binds to fruit fly Fancl.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group L. Alternative splicing results in two transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Fancl Antibody is a mouse antibody against Fancl. It can be used for Fancl detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT07283p; Fancl; Fancl
UniProt IDQ8T913
Protein RefseqThe length of the protein is 381 amino acids long.
The sequence is show below: MESNEDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHHPALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPTVPKELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLELKIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNFMDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFAALLND.
For Research Use Only | Not For Clinical Use.
Online Inquiry