AibGenesis™ Mouse Anti-Fancl Antibody (CBMOAB-16532FYA)
Cat: CBMOAB-16532FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-16532FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO16532FYA | 100 µg | ||
| CBMOAB-42570FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO42570FYA | 100 µg | ||
| CBMOAB-59938FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59938FYC | 100 µg | ||
| CBMOAB-76084FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO76084FYA | 100 µg | ||
| MO-AB-01849Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO01849Y | 100 µg | ||
| MO-AB-03492H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03492C | 100 µg | ||
| MO-AB-12363R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12363R | 100 µg | ||
| MO-AB-55247W | Monoclonal | Marmoset | WB, ELISA | MO55247W | 100 µg | ||
| MO-AB-69795W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO69795W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
| Clone | MO16532FYA |
| Specificity | This antibody binds to fruit fly Fancl. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group L. Alternative splicing results in two transcript variants encoding different isoforms. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Fancl Antibody is a mouse antibody against Fancl. It can be used for Fancl detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | AT07283p; Fancl; Fancl |
| UniProt ID | Q8T913 |
| Protein Refseq | The length of the protein is 381 amino acids long. The sequence is show below: MESNEDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHHPALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPTVPKELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLELKIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNFMDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKIIGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPKLDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTLMDGKTFLEVSFGQCPFCKAKLSTSFAALLND. |
For Research Use Only | Not For Clinical Use.
Online Inquiry